PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00128322001
Common NameGSBRNA2T00128322001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 213aa    MW: 24849.5 Da    PI: 11.2045
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00128322001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.45.1e-3152103152
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 
                          kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQ 
  GSBRNA2T00128322001  52 KPRLRWTDELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQV 103
                          79*************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.23949110IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2949105IPR009057Homeodomain-like
SuperFamilySSF466894.66E-1551104IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-2252103IPR006447Myb domain, plants
PfamPF002491.7E-754103IPR001005SANT/Myb domain
PfamPF143796.0E-17153185IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MIKSLKYILH IFQRVVYVQI HPPTRLFVFA VRKRTRALTR IRDPTILTTD PKPRLRWTDE  60
LHERFVDAVT QLGGPDKATP KTIMRTMGVK GLTLYHLKSH LQVNKLIPQS CEKKKETKIK  120
SSVVVEPCFD EFQLCRITVL QNLFICMQTR GYQVTEALRA QMEVHRRLHE QLEAQRRLQL  180
RIEANKGSTC NRFLRKLARP LTSKLLLLLG LR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.134798e-59seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00128322001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0503552e-65AY050355.1 Arabidopsis thaliana AT3g24120/MUJ8_3 mRNA, complete cds.
GenBankAY0884282e-65AY088428.1 Arabidopsis thaliana clone 6626 mRNA, complete sequence.
GenBankAY0940462e-65AY094046.1 Arabidopsis thaliana AT3g24120/MUJ8_3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010550833.11e-57PREDICTED: myb family transcription factor APL-like
SwissprotQ9SAK55e-42APL_ARATH; Myb family transcription factor APL
TrEMBLA0A078CN421e-155A0A078CN42_BRANA; BnaA07g05970D protein
STRINGBra028359.1-P1e-55(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM134061520
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.18e-59G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]